Protein Info for ABIE53_001901 in Paraburkholderia graminis OAS925

Annotation: ribose transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 42 to 306 (265 residues), 135.7 bits, see alignment E=8.8e-44

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 41% identity to cag:Cagg_2907)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>ABIE53_001901 ribose transport system permease protein (Paraburkholderia graminis OAS925)
MHSLIRRHVPLNAAAYIVAGLIVMLFVAGASVNDRFSTLSNLLNVHQQATGLALVALGQT
LAVLTGGIDLSVGSLISVSATLTSGLSEATQGGWAVAIAVAIALSVLVGLVNGLLVLWLR
VHPLIVTLGMGAVLQGGILYYANGPAGGVPDGFDALAYGRYANVPVTATVVLLLYGCVSY
FMRNTRLGRYVYLVGDDDNSATLSGIPRKRVILFVYTFSSLCAGLTGIYLAAQFGSGQPY
LGANYTLASITPVVVGGTILSGGRGGVIGTLLGVYLLSMLNNLINFAGVPSQYQLIVQGV
AIIAAVCVNVQQKRRLA