Protein Info for ABIE53_001851 in Paraburkholderia graminis OAS925

Annotation: two-component system C4-dicarboxylate transport sensor histidine kinase DctB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details PF02743: dCache_1" amino acids 74 to 256 (183 residues), 47.5 bits, see alignment E=2.5e-16 PF02518: HATPase_c" amino acids 530 to 636 (107 residues), 79.2 bits, see alignment E=4.9e-26 PF14501: HATPase_c_5" amino acids 532 to 621 (90 residues), 26 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 91% identity to bug:BC1001_2116)

Predicted SEED Role

"C4-dicarboxylate transport sensor protein dctB (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (646 amino acids)

>ABIE53_001851 two-component system C4-dicarboxylate transport sensor histidine kinase DctB (Paraburkholderia graminis OAS925)
MVSDASRSGAARAWRRRASGIREVEHQVRIRGIPLWVWAIAALLYAGMAAAAIELAWNRA
IDALAEAGAHQLDLYGASLKSELGRFEMMPAIVARQDSVRALLNAGPHASPALVQGVNTY
LEAVNQEAGSVAVDVIDLQGSVIAASNWNQPLSFVGTNVSYRPYFKDALARGSGRFFGIG
TNTGIPGLYFASAVRDGGKAIGAAAVKISVDELESAWRRPNEAAMVIDHNGVIVISTVAA
WKFTALRPITSEQQREIQASRQYAGRLVEPLQYRRIGEWGASAWLGRFPDPRRPGHTTRY
LAMSRPAPQAGDSIMVLLDVAGARRQQELALGFVTGGFLIAGLYALYAVQRRRTIAEKLK
AQDALRRANDELEATVAQRTAALTQTNERMQQEIAERKRTEERLRESQQEVVHAGKLAVL
GQMAAGLTHELSQPLVAIRTLCDNARTFFERDQPAHAITNLERVSRLVDNMATLTGELKA
FARKPVVERVAVSLNEAVAHARLIYDARIRDEAVQVDVRMAPGTLVCAEASQLQQVIVNL
LGNALDAVREQEQRVITLEATESADNGRVLFSIADSGTGIAPEVLEHLFEPFVTTKPRGH
GLGLGLAITSRIVEAFGAKISAVNRDEGGARFNIEFASAKGVVDGR