Protein Info for ABIE53_001850 in Paraburkholderia graminis OAS925

Annotation: malate:Na+ symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 134 to 150 (17 residues), see Phobius details amino acids 162 to 186 (25 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 368 to 393 (26 residues), see Phobius details amino acids 437 to 456 (20 residues), see Phobius details PF03390: 2HCT" amino acids 42 to 451 (410 residues), 508.3 bits, see alignment E=7e-157

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_2117)

Predicted SEED Role

"Malate Na(+) symporter" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>ABIE53_001850 malate:Na+ symporter (Paraburkholderia graminis OAS925)
MSTPAHTQDASRSTPALDAAPLSNEKTRFWPEGWWKLMEYRIGIIPLPVYFILLALIVGF
AVTGKMPGEISMAIAVLAFFGFTCAELGKRLPLLRNIGAAAICATFVPSALTYYHVLPKP
ILHLTTEFTKSTNFLYLFIASIIVGSILSMDRRVLIRGFVKIFVPLALGSLAAAIVGIAV
GAAFGLGARHTLLYIVVPIMAGGVGEGAIPLSIGYSEIMHLPQGELFAQVLPPVMLGSLT
AIVLSGALDMLGKRFPHLTGDGRLQVGETDEMAPAEEEIRGHIDVTHIAAAGITAITLYL
LGLMCRNLFGLPAPVAMLFLAVLVKLARAVSPQLQEGAFVVYKFFSTAVTYPLLFAIGVA
MTPWDKLMAAFTIANIVTIVATVATLMGTGFLVARKLKMYPIDTAIVNACHSGQGGTGDV
AILTAANRMQLMPFAQIATRIGGAIVVTVTLIAVAHGV