Protein Info for ABIE53_001796 in Paraburkholderia graminis OAS925

Annotation: Amt family ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 342 to 366 (25 residues), see Phobius details PF00909: Ammonium_transp" amino acids 12 to 391 (380 residues), 296 bits, see alignment E=1.9e-92

Best Hits

KEGG orthology group: None (inferred from 98% identity to bgf:BC1003_2028)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>ABIE53_001796 Amt family ammonium transporter (Paraburkholderia graminis OAS925)
MASLKTGTDTLFLLLGAAMVLAMHAGFAFLELGTVRKKNQVNALVKILVDFSVSTIAYFF
IGYTIAYGVQFFDNAGTLAAHNGYALVRFFFLLTFAAAIPAIVSGGIAERSKFNPQLFAT
FVLVGFVYPFFEGIAWNERFGVQAWIAQMFGVPFHDFAGSVVVHAFGGWVALPAVLLLGA
RHGRYHRDGGIAAHPPSNIPFLALGAWVLAVGWFGFNVMSAQTVDKISGLVAVNSLMAMV
GGTLTAWLAGRNDPGFTYNGPLAGLVAVCAGSDLMHPLGALVTGGIAGVLFVYMFTCVQN
RWRIDDVLGVWPLHGLCGAWGGVAAGIFGLRALGGMGGVSFGAQVLGTLGGIVVATLGGT
LVYGAIRLTVGLRLDQEDEYNGADLSIHKISATPERESLG