Protein Info for ABIE53_001795 in Paraburkholderia graminis OAS925

Annotation: CrcB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details TIGR00494: protein CrcB" amino acids 6 to 118 (113 residues), 99.1 bits, see alignment E=1.1e-32 PF02537: CRCB" amino acids 6 to 118 (113 residues), 97.1 bits, see alignment E=3.7e-32

Best Hits

Swiss-Prot: 90% identical to CRCB_PARXL: Putative fluoride ion transporter CrcB (crcB) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K06199, CrcB protein (inferred from 95% identity to bgf:BC1003_2029)

MetaCyc: 50% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"Integral membrane protein possibly involved in chromosome condensation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>ABIE53_001795 CrcB protein (Paraburkholderia graminis OAS925)
MYWSILAVAIGGALGSLFRWFLGLRLNALFPSLPLGTFAANVIAGYVIGVAVAGFARAPQ
IAPEWRLFVITGMMGGLSTFSTFSAEVVQHLQDGRLGWAAGEVAIHVGASLCMTVLGIAT
VALLSR