Protein Info for ABIE53_001597 in Paraburkholderia graminis OAS925

Annotation: NADH-quinone oxidoreductase subunit H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details PF00146: NADHdh" amino acids 27 to 342 (316 residues), 416.7 bits, see alignment E=2.8e-129

Best Hits

Swiss-Prot: 97% identical to NUOH_PARXL: NADH-quinone oxidoreductase subunit H (nuoH) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to bug:BC1001_1091)

MetaCyc: 52% identical to MbhM (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>ABIE53_001597 NADH-quinone oxidoreductase subunit H (Paraburkholderia graminis OAS925)
MSLFDTINSGGTQLLGVAWPTVWALVRILVVAVVILLCVAYLILWERKLIGWMHVRLGPN
RVGPAGLLQPIADVLKLLLKEVIQPTQASRWIYMIAPIMVVVPAFAVWAVIPFQAGAVLG
DINAGLLYAIAISSIGVYGVILAGWASNSKYAFLGAMRAAAQMVSYEISMGFALVVVLMT
AGTLNLSDIVGSQERGFFAAHGLNFLSWNWLPLLPMFVVYFISGIAETNRHPFDVVEGES
EIVAGHMIDYSGMAFALFFLAEYINMIVISALASTLFLGGWSAPFGFLSFIPGIFWLVLK
VFLLLSVFIWARATFPRYRYDQIMRLGWKIFIPVCVVWLVVVGFWIMSPWNIWK