Protein Info for ABIE53_001567 in Paraburkholderia graminis OAS925

Annotation: diacylglycerol kinase (ATP)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 93 to 110 (18 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details PF01219: DAGK_prokar" amino acids 76 to 175 (100 residues), 109.1 bits, see alignment E=4.5e-36

Best Hits

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 91% identity to bxe:Bxe_A3238)

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.107

Use Curated BLAST to search for 2.7.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>ABIE53_001567 diacylglycerol kinase (ATP) (Paraburkholderia graminis OAS925)
MNHAEAHRMSGHEGHARHSRVDGDGDESAGINRHGSHAAAEIQHEPLSPDDPLAPLPFNP
YKGNRGLTRAWHAMKNSLAGFRVAIREESAFRQELTLAAILLPCGVLVPVEPVSRVLLLG
SVLLVLIVELLNSSVEAAIDRISLERHELSRRAKDLGSAAVMVALGMCVMTWGLIVGPLG
VDWVKAWL