Protein Info for ABIE53_001537 in Paraburkholderia graminis OAS925

Annotation: DNA-binding GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00392: GntR" amino acids 22 to 81 (60 residues), 55.7 bits, see alignment E=3.2e-19 PF07729: FCD" amino acids 95 to 214 (120 residues), 90 bits, see alignment E=1.7e-29

Best Hits

Swiss-Prot: 38% identical to YIN1_STRAM: Uncharacterized HTH-type transcriptional regulator in unstable DNA locus from Streptomyces ambofaciens

KEGG orthology group: None (inferred from 88% identity to bge:BC1002_6499)

Predicted SEED Role

"predicted biotin regulatory protein BioR (GntR family)" in subsystem Biotin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>ABIE53_001537 DNA-binding GntR family transcriptional regulator (Paraburkholderia graminis OAS925)
MKNNASSSVVTRLDRSRHAAPQVFERLREMILSLELTPGTVLSRAELANRYGLSQTPVRD
ALMKLGEEGLVDIFPQHATVVSQINVSSALQAHFLRRSIELEVVRTLAEQHDAALIAALR
ATIARQTELLDLNNYERFALFDQTFHRQMYEAAGVPQLWDLVRRLSGHIDRLRRLHLPVE
GKTMAVVQEHTEIVDAIERGDATAAQAALRGHLSGTLHQIEQIRTSHPDFLTDD