Protein Info for ABIE53_001521 in Paraburkholderia graminis OAS925

Annotation: purine-cytosine permease-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details amino acids 435 to 452 (18 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 19 to 440 (422 residues), 171.4 bits, see alignment E=1.6e-54

Best Hits

KEGG orthology group: None (inferred from 92% identity to bpy:Bphyt_2364)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>ABIE53_001521 purine-cytosine permease-like protein (Paraburkholderia graminis OAS925)
MNTSQANASPLIEKHTIGYVPPEERHGKVRDLFTLWFGGNIAPLPIVTGALGVQIFHLNL
VWGIVAIIVGQAVGGVLMALHSAQGPQMGIPQMIQSRAQFGSWGALLVTVIAGVMYVGFF
ASNIVLAGKSLHGIEAGVPVPIGIVIGAVGSGLIGIIGYRFIHILNRIGTWVLGVGIVIG
FGYIFTHISTGDFLTRGGFNFAGWLATVSLSALWQIAFAPYVSDYSRYLPANVRVASTFW
ATYLGCTIGSTLAFAFGAVAVLAVPPGVDAMDAVKQATGPLGLPMLVLFLLSVISHNALN
LYGAVLATITSMQTFAYRWVPTAKARAVLSIVILLACCYGAIGASTNFVGNLVDLVLALL
VVLVPWTAINLIDFYVIHKGKYDIQSIFQVDGGIYGRFNPQALIAYAVGIVVQIPFMNTP
MYAGPVPKYLDGADLSWLIGLLLTSPLYYWLASRDSHYRRRQAGASVVRRTAPTMSVSKA
DS