Protein Info for ABIE53_001514 in Paraburkholderia graminis OAS925

Annotation: spermidine/putrescine ABC transporter ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 743 PF00005: ABC_tran" amino acids 23 to 165 (143 residues), 134.9 bits, see alignment E=4.7e-43 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 38 to 363 (326 residues), 364.2 bits, see alignment E=2.8e-113 PF08402: TOBE_2" amino acids 282 to 361 (80 residues), 54.3 bits, see alignment E=1.8e-18 PF13416: SBP_bac_8" amino acids 439 to 708 (270 residues), 175.9 bits, see alignment E=2.3e-55

Best Hits

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (743 amino acids)

>ABIE53_001514 spermidine/putrescine ABC transporter ATP-binding subunit (Paraburkholderia graminis OAS925)
MSNPSFISLSRVSKTYDGVQLVVDDLNLDVSKGEFVSLLGPSGSGKTTTLMMLAGFESPT
HGEIRLDGRRLDDKPPHQRDIGMVFQNYALFPHLTIAENVAFPLSVRHVGRAEQKARVKR
ALEMIELPHLANRRPAQLSGGQQQRVALARALVFEPSVVLMDEPLGALDKRLRETMQYEI
MRLHRELSLTIVYVTHDQAEALTMSDRVAVFSDGRIQQAATPSELYENAQNAFVANFVGE
NNGLTGRVVNAHEGWATLALSNGSMIRGRCENGLHAGDEAMLALRPERAHIPGAEGTQPT
EHDNVVRARVDELVYCGDHHRVHLTLGSRDSIVVKVPNTQRHALPTPGSEIDVAWRHDDC
KILAMSARAAARRRFTYPHRPPLPSSRPHQQEPTDMRTIIKAQCAALAVLAFATVTTQAA
ETLSVVTFGGAYEAAAKKAYFEPFTQATGVGFSTESYDGGLAKLSAMEQAKNTTWDLIDL
ETNDAITACDEGLLQKFDKKTIGKTSDFIPGSISDCAVASMVWSTVYAYDASKMKTAPST
VNDFFDLQKFPGKRGLRKSPKVSMEWALIADGVAPKDVYKVLATPAGVDRAFKKLDTIKK
NIVWWESGAQAPQLLADGAVVMTQAYNGRISDAAQKDNKPFKTVWDAQVYDFDWWGVPTG
AKHADLAAKFIASASQPKAYADLSKYIAYAPPRKDAIALVDKQRLADLPTAPDNFKRALQ
INANFWADNADQINKRFQVWLTQ