Protein Info for ABIE53_001461 in Paraburkholderia graminis OAS925

Annotation: cytochrome c oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 35 to 61 (27 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 146 to 159 (14 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details PF00510: COX3" amino acids 81 to 208 (128 residues), 40.3 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: None (inferred from 74% identity to bug:BC1001_5386)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1) / Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>ABIE53_001461 cytochrome c oxidase subunit 3 (Paraburkholderia graminis OAS925)
MTTVDERYAEGRPRAARKAIHVGELPTYGFSHRSLMWWGTMGLMVIEGTVFAIAVMMYFY
LRTLASVWPMNAPGPGLLWGSVNTAILVVSMLPNHLAKRAAEREDRAASRLWLLVCLAFS
LAFLGVRALEFKALNVTWYDNAYGSVLWMLMGLHTVHLITDTFDTAVLDVLLFTGPVEGK
RYVDVSENAAYWYFVVLSWLPIYAVVYWAPRL