Protein Info for ABIE53_001424 in Paraburkholderia graminis OAS925

Annotation: electron transport complex protein RnfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 63 to 218 (156 residues), 212.2 bits, see alignment E=2.5e-67 PF04060: FeS" amino acids 73 to 105 (33 residues), 47.2 bits, see alignment 5e-16 PF12837: Fer4_6" amino acids 138 to 160 (23 residues), 25.3 bits, see alignment (E = 4e-09) PF14697: Fer4_21" amino acids 138 to 192 (55 residues), 65.3 bits, see alignment 1.5e-21 PF13237: Fer4_10" amino acids 139 to 186 (48 residues), 28.9 bits, see alignment 3.3e-10 PF00037: Fer4" amino acids 139 to 160 (22 residues), 29.2 bits, see alignment (E = 2.1e-10) amino acids 169 to 191 (23 residues), 21.3 bits, see alignment (E = 6.5e-08)

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 80% identity to bgf:BC1003_1019)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>ABIE53_001424 electron transport complex protein RnfB (Paraburkholderia graminis OAS925)
MAHGLRMAIGEIGDNVVLSSSCAAARRDALESPASRLLVLCCSPASPLPGLASPHLVTVT
LIKTLADRIEDLLPQTQCTKCGYPACRPYAEAVACGEASYNQCPPGGAEGVARLAALLGK
PVIPLNPANGVERPRPLAVIDEQICIGCTLCMQACPVDAIVGAPKHMHTVVAELCTGCDL
CVPPCPVDCISMQPVTGEATGWDAWSQPQADAARERHERRDARLAQEREAAEARVAARRS
SAGAVGTAVGEPPASAPPAGASASAAAALSAPATDDAEAKKRAIIQAALERARKKKEELA
AKGQAPLNTEHVSADVQAQIDAAEARRRRLGLADNNDNNNADTDTAAANTPPIPAGTRNP
R