Protein Info for ABIE53_001371 in Paraburkholderia graminis OAS925

Annotation: DNA mismatch endonuclease (patch repair protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR00632: DNA mismatch endonuclease Vsr" amino acids 1 to 118 (118 residues), 146.8 bits, see alignment E=1.7e-47 PF03852: Vsr" amino acids 3 to 73 (71 residues), 108.4 bits, see alignment E=6.4e-36

Best Hits

Swiss-Prot: 52% identical to VSX2_XANOR: XorII very short patch repair endonuclease (vsr) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: K07458, DNA mismatch endonuclease, patch repair protein [EC: 3.1.-.-] (inferred from 93% identity to bug:BC1001_0890)

Predicted SEED Role

"Very-short-patch mismatch repair endonuclease (G-T specific)" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>ABIE53_001371 DNA mismatch endonuclease (patch repair protein) (Paraburkholderia graminis OAS925)
MVDIVDSATRSRMMSGIRGRNTKPEVLIRSLLHRQGFRFRLNARDLPGRPDIVLPRYRAV
VLVHGCFWHGHDCPLFKWPQTRPEFWREKIGRNRANDDKVRAALLAAGWRVGVVWECALR
GANRDIEGVLTRLVEWLKSDAPSFEERA