Protein Info for ABIE53_001327 in Paraburkholderia graminis OAS925

Annotation: putative ABC transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 17 to 20 (4 residues), see Phobius details transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 18 to 208 (191 residues), 38.7 bits, see alignment E=1.3e-13 PF02687: FtsX" amino acids 260 to 373 (114 residues), 44.1 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 98% identity to bgf:BC1003_4010)

Predicted SEED Role

"ABC-type antimicrobial peptide transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>ABIE53_001327 putative ABC transport system permease protein (Paraburkholderia graminis OAS925)
MHALKLITRNALRHKLRTALTVLGLTIAVLAYGLLNTVVDAWYAGAAAASNARLVTRNAI
SLTFSLPLSYENRIRGVEGVTLVARSSWFGGVYREPKNFFAQFAVSDNYLDLYPELIVPA
QQRSDYVRDRKGCLVGRQLATQFGFKVGDVIPIKGTIYPGTWEFVVRGIMDGRDESTITR
QLIFHWDYLNESVRKMPGRRADQVGVYVLGIAVPEEAAAISRNVDDVFKNSLAETLTETE
QAFQLGFVAMSNQIIAAIRVVSYVVIVIIMAVMANAMAMSARERTVEYATLKALGFGPGF
LALLMFGESLTLCIAGGGLGMLLTPPAASIFRQATGGVFPVFHVSRDTVLLQAACAGVVG
VAAAIIPAIQAARVRIVEGLRAIG