Protein Info for ABIE53_001198 in Paraburkholderia graminis OAS925

Annotation: urease subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00547: Urease_gamma
  • amino acids 1 to 99 (99 residues), 162.5 bits, E=1.3e-52
• TIGR00193: urease, gamma subunit
  • amino acids 1 to 99 (99 residues), 179.2 bits, E=7.8e-58

Best Hits

Swiss-Prot: 100% identical to URE3_BURM1: Urease subunit gamma (ureA) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: K01430, urease subunit gamma [EC: 3.5.1.5] (inferred from 96% identity to bgd:bgla_1g08170)

MetaCyc: 70% identical to urease gamma subunit (Sinorhizobium meliloti Rm2011)
Urease. [EC: 3.5.1.5]

Predicted SEED Role

"Urease gamma subunit (EC 3.5.1.5)" in subsystem Urea decomposition (EC 3.5.1.5)

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Purine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.5

Use Curated BLAST to search for 3.5.1.5

Protein Sequence (100 amino acids)

>ABIE53_001198 urease subunit gamma (Paraburkholderia graminis OAS925)
MKLTPREKDKLLIFTAALLAERRRARGLKLNYPEAVAFITAALMEAARDGKTVAEVMHYG
TTLLTRDDVMEGVPEMIPDIQVEATFPDGTKLVTVHHPIP