Protein Info for ABIE53_001175 in Paraburkholderia graminis OAS925

Annotation: diacylglycerol kinase (ATP)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01219: DAGK_prokar
  • amino acids 39 to 138 (100 residues), 111.5 bits, E=8e-37

Best Hits

KEGG orthology group: None (inferred from 69% identity to bge:BC1002_1060)

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

• phosphatidate metabolism, as a signaling molecule (2/5 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.107

Use Curated BLAST to search for 2.7.1.107

Protein Sequence (151 amino acids)

>ABIE53_001175 diacylglycerol kinase (ATP) (Paraburkholderia graminis OAS925)
MLLRMSRMNRSMRRPNDPPPSPVAPKRSGVLRGLFALRHSYDGFLTTLREESAFRQETAL
AAVLMPFALLLPVTPVERVLLISSLLLVLLVELLNSSIEATIDRISLERHELSKRAKDCG
SAAVTLSLLICATVWLLLAGPVVVRLAEAYL