Protein Info for ABIE53_001135 in Paraburkholderia graminis OAS925

Annotation: bis(5'-nucleosyl)-tetraphosphatase (symmetrical)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00149: Metallophos" amino acids 62 to 198 (137 residues), 39.4 bits, see alignment E=4.5e-14 TIGR00668: bis(5'-nucleosyl)-tetraphosphatase (symmetrical)" amino acids 64 to 309 (246 residues), 224.9 bits, see alignment E=7.1e-71

Best Hits

Swiss-Prot: 82% identical to APAH_PARP8: Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (apaH) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K01525, bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [EC: 3.6.1.41] (inferred from 92% identity to bgf:BC1003_0745)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC 3.6.1.41)" (EC 3.6.1.41)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>ABIE53_001135 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (Paraburkholderia graminis OAS925)
MAAAPRDAGAANGLLCHALLLHRPNAASLLHRRAYRTANIPPMTPSTAPSPALPISQQPV
PLAFGDLQGCRTPFQRLLAKAAPPAGTPLWFAGDLINRGAESLATLRDIIALGDRAVPVL
GNHDLHLMSVSAGIRKSKKGDTIDDILSAPDAADLLEWVRHRPIAHYENGMLMVHAGVVP
QWDVNLTLELADELQRALRAPNWKETLAGLYGNEPSLWTPQLKGIERLRVTCSALTRVRF
CKAEGAMDFSSSGGLNAAPPGCMPWFDVPWRKTADVTVVFGHWAALGLTLRDNLIGLDSG
CVWGEKLSAVLLAANPAERTLTQVECENCRARGGN