Protein Info for ABIE53_000976 in Paraburkholderia graminis OAS925

Annotation: haloacetate dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00561: Abhydrolase_1" amino acids 26 to 164 (139 residues), 95.6 bits, see alignment E=5.8e-31 PF12146: Hydrolase_4" amino acids 27 to 146 (120 residues), 29.4 bits, see alignment E=7.6e-11 PF12697: Abhydrolase_6" amino acids 28 to 284 (257 residues), 64.1 bits, see alignment E=4.6e-21

Best Hits

Swiss-Prot: 44% identical to DEHA_RHOPA: Fluoroacetate dehalogenase (RPA1163) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01561, haloacetate dehalogenase [EC: 3.8.1.3] (inferred from 91% identity to bgf:BC1003_0718)

Predicted SEED Role

"Haloacetate dehalogenase H-1 (EC 3.8.1.3)" (EC 3.8.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.3

Use Curated BLAST to search for 3.8.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>ABIE53_000976 haloacetate dehalogenase (Paraburkholderia graminis OAS925)
MFEGFSDASATVDRVRIHAIQGGRGPALLLLHGHPQTHAIWHKVAPALAERFTVVAADLR
GYGDSGKPPGDPAHANYAKRRMALDQVELMRGLGHESFAVIGHDRGGRVAARMALDHPQV
VTRLVTLDVAPTLAMYEQTSFEFARAYWHWFMLVRPAPFPETLIRANPDLYLKQTIGARS
AGLAPFTPAAYAEYLRCLSDPATAHGICEDYRASVTIDLEHDRATLASQQRIDCPFMALW
GAQGVIEQCFDPLAEWRAYAPDVQGEALPCGHYIPEEAPQRLLERVLPFLSE