Protein Info for ABIE53_000951 in Paraburkholderia graminis OAS925

Annotation: O-antigen/teichoic acid export membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 157 to 189 (33 residues), see Phobius details amino acids 214 to 226 (13 residues), see Phobius details amino acids 260 to 277 (18 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 392 to 409 (18 residues), see Phobius details PF01943: Polysacc_synt" amino acids 20 to 281 (262 residues), 64.1 bits, see alignment E=1.5e-21 PF13440: Polysacc_synt_3" amino acids 42 to 334 (293 residues), 176 bits, see alignment E=1e-55

Best Hits

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 97% identity to bug:BC1001_0534)

Predicted SEED Role

"FIG00457308: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>ABIE53_000951 O-antigen/teichoic acid export membrane protein (Paraburkholderia graminis OAS925)
MRAIRLPALSIASSFGASAATWVLLQQFAVRGLVAIKFLAIGRMLGPAAIGSVSVALLAV
AIAEALSDTGLAQAVIQGEHAPTRPQLSAVWTTLTARGVLISLLLVASAPLLSSQFHLDG
SLVLIQLAALLPLLRGLASPAYYVVQRERRFQHIAGVEVAAAFVDCSVGLTLAYFGAGAA
SVLIGLVAGETLKSVLTWVTMTPRPPVRAVWSGIGQYVGFSRWIWASSVINLLLNQFDKV
VVGKLLGPTQLGGYQMSSRLAQMLLADAAIAMSQYLFPTFAAHHRRNAQAASRLIRIYLL
VAAVGLAAFVELLRLIAEPMFSLILGAAWLPAVPLFRILVINMAIGALIAVLVSYLRAIG
DAKATVHASAIQVVVLLVSAPLAVRWWGVTGIAWSMTLGLGCAAAWMLYRTLKARTA