Protein Info for ABIE53_000859 in Paraburkholderia graminis OAS925

Annotation: ferrochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 49 to 67 (19 residues), see Phobius details TIGR00109: ferrochelatase" amino acids 14 to 340 (327 residues), 309.3 bits, see alignment E=1.7e-96 PF00762: Ferrochelatase" amino acids 17 to 339 (323 residues), 387 bits, see alignment E=3.2e-120

Best Hits

Swiss-Prot: 95% identical to HEMH_PARXL: Ferrochelatase (hemH) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K01772, ferrochelatase [EC: 4.99.1.1] (inferred from 96% identity to bgf:BC1003_0459)

Predicted SEED Role

"Ferrochelatase, protoheme ferro-lyase (EC 4.99.1.1)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.99.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>ABIE53_000859 ferrochelatase (Paraburkholderia graminis OAS925)
MRFDLERPSQNATSHRVAVLLINLGTPDAPTPRAVRRYLAQFLSDPRVVEIPALLWQIIL
RLLILPFRGRASAKKYAAVWMPEGSPLRVYTEKQVEALRHLLQLNDYTVLVEYAMRYGTP
GIPAMLNQLKLAGAERVLLVPMYPQYSSSTTATAFDDAFSAMKRMRNQPEIRTVRQYADH
PAYIAALAAQVRHYWHLHGQPDFAAGDKLVLSFHGVPKRTLDLGDPYHEQCQTTGALLMQ
ALGLTSVECRITFQSRFGKAEWLQPYTAPTLKELGAAGVRRADVFCPGFTADCLETIEEI
GMEVRDEFLHAGGKEFHRIPCVNASQAWIAALGEIVAQNLQGWPVQAVPVPHNTAA