Protein Info for ABIE53_000714 in Paraburkholderia graminis OAS925

Annotation: UPF0042 nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03668: ATP_bind_2" amino acids 1 to 284 (284 residues), 294.8 bits, see alignment E=3.5e-92

Best Hits

Swiss-Prot: 95% identical to Y336_PARXL: Nucleotide-binding protein Bxeno_A0336 (Bxeno_A0336) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 99% identity to bug:BC1001_0307)

Predicted SEED Role

"Hypothetical ATP-binding protein UPF0042, contains P-loop"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ABIE53_000714 UPF0042 nucleotide-binding protein (Paraburkholderia graminis OAS925)
MRIILITGISGSGKSVALNALEDAGYYCVDNLPPRFLPELASYLAEDGHDRLAVAIDARS
SASLDDMPAMIRDLSRAHDVRVLFLNASTQSLIQRFSETRRRHPLSGSTAHDADVGLLTS
LAEAIERERELVAGLAEFGHQIDTSNLRANVLRQWVKRFIEQEHAGLVLMFESFGFKRGV
PLDADLVFDVRTLPNPYYDHELRPLTGLDKPVIDFLDALPVVHEMIDDIEKFLAKWLPHF
RDDNRSYLTVAIGCTGGQHRSVFIAETLAARLANAANVIVRHRDAPVDAGASSKLVA