Protein Info for ABIE53_000680 in Paraburkholderia graminis OAS925

Annotation: surfeit locus 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 207 to 226 (20 residues), see Phobius details PF02104: SURF1" amino acids 13 to 216 (204 residues), 152 bits, see alignment E=1.4e-48

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_0274)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>ABIE53_000680 surfeit locus 1 family protein (Paraburkholderia graminis OAS925)
MKFRLVPALLILLVVAVTMRLGFWQRDRAHQKEALEARITQFENAPAQPVTRAPVALKDI
EFHRVKARGTFVADKVVYLDNRPYNDQPGFYVVMPFKLADGGYVLINRGWLPRNMSNRET
IAPYVTPQGEIEIEGIARADASRAYELGQGGSAAHQPIRQNLDIAAYAAETGLPLQPFVI
QQLSDDGDKLVRDWPAPTSGVERNYGYMFQWWGMAAAAVAFGLYAARRAARKEHAPGV