Protein Info for ABIE53_000667 in Paraburkholderia graminis OAS925

Annotation: glycerol-3-phosphate dehydrogenase (NAD(P)+)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01210: NAD_Gly3P_dh_N
  • amino acids 2 to 159 (158 residues), 136.7 bits, E=1e-43
• PF07479: NAD_Gly3P_dh_C
  • amino acids 181 to 321 (141 residues), 181.2 bits, E=2e-57
• PF20618: GPD_NAD_C_bact
  • amino acids 241 to 307 (67 residues), 75.8 bits, E=4.5e-25

Best Hits

Swiss-Prot: 96% identical to GPDA_PARXL: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 97% identity to bug:BC1001_0261)

MetaCyc: 41% identical to glycerol-3-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). [EC: 1.1.1.94]

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Protein Sequence (332 amino acids)

>ABIE53_000667 glycerol-3-phosphate dehydrogenase (NAD(P)+) (Paraburkholderia graminis OAS925)
MKVAVLGAGAWGTALAGHLAVRHDTVLWAREPALVTDLAASHENARYLAGVALPAALRYE
ADLNAALDHALADDALCVVATPVAGLRSLIQSMRDAGKVPAHVVWLCKGFEADSQLLPHQ
VVAAELPEHGSNGVLSGPSFAREVGQGLPVALTIASASAACRERTVAAFHHGAMRIYTGD
DVVGVEVGGAVKNVLAIATGIADGLGLGLNARAALITRGLAEMSRLGVTLGGRAETFTGL
TGLGDLILTATGDLSRNRTVGVQLAAGRSLADILGGLGHVAEGVRCAQAVLAIARAHAIE
MPITQAVCAVLFDGVAPRDAVSALLRRDSKAE