Protein Info for ABIE53_000648 in Paraburkholderia graminis OAS925

Annotation: two-component system C4-dicarboxylate transport response regulator DctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 89.9 bits, see alignment E=3e-29 PF00158: Sigma54_activat" amino acids 147 to 313 (167 residues), 229.1 bits, see alignment E=6.7e-72 PF14532: Sigma54_activ_2" amino acids 148 to 318 (171 residues), 70.8 bits, see alignment E=3.5e-23 PF07728: AAA_5" amino acids 171 to 288 (118 residues), 23.5 bits, see alignment E=1.2e-08 PF02954: HTH_8" amino acids 400 to 440 (41 residues), 40.7 bits, see alignment 3.9e-14

Best Hits

Swiss-Prot: 55% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 98% identity to bug:BC1001_0243)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>ABIE53_000648 two-component system C4-dicarboxylate transport response regulator DctD (Paraburkholderia graminis OAS925)
MLNDGLQVLYIEDDELVRRASVQSLQLAGFEVVGHASAESAAKSISADFSGVIVSDIRLP
GASGLELLAQCHERAPDVPVILVTGHGDISMAVQAMRDGAYDFIEKPFASERLIETVRRA
LERRKLVLENLALRRELAGQNTVAPRIIGRSPAIEQVRRLIANVAPTDASVLINGDTGAG
KELIARSLHELSPRRDKPFIAVNCGALPEPMFESEMFGYEPGAFTGAAKRRIGKLEHASG
GTLFLDEIESMPLALQVKLLRVLQDGVLERLGSNQPIRVNCRVVAAAKGDMAEHVADGSF
RRDLLYRLNVVTIALPPLGERREDIVPLFEHFLLDAAVRYQRPAPILTDRQRASLMQRDW
PGNVRELRNAADRFVLGVADDPVMSFGDDGGQAQPLKERVEQFERAVIAEALEQCGGAVA
VAADRLQLGKATLYEKIKRYGLAAKGDGER