Protein Info for ABIE53_000462 in Paraburkholderia graminis OAS925

Annotation: fucose permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 339 (307 residues), 70 bits, see alignment E=9.1e-24

Best Hits

KEGG orthology group: None (inferred from 95% identity to bug:BC1001_0124)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>ABIE53_000462 fucose permease (Paraburkholderia graminis OAS925)
MSDRSTDFAAIPAAHRNLSDTARQRARIATMALFFIAGMVYGSWGVHVPTVRDRFHLSPA
LLSVALLAVAGGSIGAMAANASWIARVGTRRACLTGGLVMSVCVALILVVPFYWMLLVVL
ALFGAGMATLDVAMNAEASAVEKALRKPIMSSLHGMFSVGGMVGAAVGGALLAHGMAPAV
HLGLAAAVSALVLIAACPSVLPHVPHDEHPDSATPRANRWRSPALWALGTVALVALIAEG
AMYDWATVYMRDVVLSSPAAASAAYAAFSGGMAAARFAGDAVRARFGAPQLVMASATLAL
AGMIGALLVPTPVAALTGFTLMGLGLANMMPVLFAAAASVKGIHAAEGLAHVAGLAYFGM
LFGPVLIGAVAQVTNLSIGLSVVAVCCALIAIAGPKVLQRLKI