Protein Info for ABIE53_000428 in Paraburkholderia graminis OAS925

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00652: diaminopimelate epimerase
  • amino acids 17 to 296 (280 residues), 295.1 bits, E=2.6e-92
• PF01678: DAP_epimerase
  • amino acids 18 to 138 (121 residues), 113.1 bits, E=4.3e-37
  • amino acids 174 to 290 (117 residues), 107 bits, E=3.5e-35

Best Hits

Swiss-Prot: 93% identical to DAPF_PARPJ: Diaminopimelate epimerase (dapF) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 96% identity to bgf:BC1003_0113)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Protein Sequence (300 amino acids)

>ABIE53_000428 diaminopimelate epimerase (Paraburkholderia graminis OAS925)
MRALEGRVTYNSVMKLKFTKMHGAGNDFVVLDGYTQALNLTPEQVRALADRHFGVGADQL
LLVEKPTVDGVDFRYRIFNCDGGEVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQNGTIT
LTMQENGEVLVDMGSPVFEPERVPFATKGLQGRREGADTLWPLDVNGTTRWISVVSMGNP
HAVQVVDDVEAFPVLVEGPVIERHARFPQKVNAGFMQIVGRSEIKLRVYERGAGETLACG
TGACAAVAAGIRRGLLDAPVLVHTHGGKLTISWDSNKESEPLLMAGPATTVFQGEIELAD