Protein Info for ABIE53_000424 in Paraburkholderia graminis OAS925

Annotation: G3E family GTPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF02492: cobW" amino acids 3 to 183 (181 residues), 194.1 bits, see alignment E=1.7e-61 PF07683: CobW_C" amino acids 279 to 373 (95 residues), 84.6 bits, see alignment E=3.5e-28

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_0087)

Predicted SEED Role

"Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>ABIE53_000424 G3E family GTPase (Paraburkholderia graminis OAS925)
MIPVTILTGFLGSGKTTLLKRILNEKHGMKIAVIENEFGEENIDNEILVQDTSEQIIQMS
NGCICCTIRGDLSRVLSDLAAQKQSGKLDFDRVVIETTGLANPGPVAQTFFMDDQIASEF
LLDAIITLVDAKHANHQLDEHEVVQRQVGFADRLFITKADLVDEAQLGDLRHRLLHMNPK
AAIKVVNFGDADIKEIFDLRGFNLNSKLEIDPDFLVEDEHAHNHAHAHDEHGHTHGHDHD
HANCDHDHGHCDHEGHEGHEGHEGHDHAHHHHAHHDDKIKSFVYRNDRPFDPNKLEDFLG
GILQIYGERLLRYKGVLYMKGVDRKVVFQGVHQMMGSDLAAKWQPAEKKTNKMVFIGIEL
PQDLITDGLDACLA