Protein Info for ABIE53_000401 in Paraburkholderia graminis OAS925

Annotation: rod shape determining protein RodA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 319 to 346 (28 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 20 to 377 (358 residues), 418.6 bits, see alignment E=1.1e-129 PF01098: FTSW_RODA_SPOVE" amino acids 25 to 378 (354 residues), 335.3 bits, see alignment E=2.1e-104

Best Hits

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 98% identity to bxe:Bxe_A4402)

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>ABIE53_000401 rod shape determining protein RodA (Paraburkholderia graminis OAS925)
MQFDKRAWLDRIKRMFAGFDRPLALIVFLLLCVGIITLYSASLDVPGRVEDQLRNIMLTF
VLMWALANVPPTTLMRFAVPLYTFGIALLVAVALFGLTRKGAKRWINVGVVIQPSEILKI
ATPLMLAWYYQRREGVMRWYDFVVGLLILAVPVGLIAKQPDLGTAVLVFAAGLFVIYFAG
LSFKLIVPVLIAGVIAVGSVAAFQDKICQPDVQWPLMHDYQKHRICTLLDPTSDPLGKGF
HTIQAVIAIGSGGPLGKGWLKGTQAHLEFIPEKHTDFIFAVFSEEFGLAGGIVLLTLYML
LIARGLYIAANGATLFGRLLAGSLTMAFFTYAFVNIGMVSGILPVVGVPLPFMSYGGTAL
TTLGVAIGLIMSVARQKRLMQS