Protein Info for ABIE53_000305 in Paraburkholderia graminis OAS925

Annotation: general secretion pathway protein L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 46 to 63 (18 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details TIGR01709: type II secretion system protein L" amino acids 6 to 471 (466 residues), 297.9 bits, see alignment E=6.1e-93 PF05134: T2SSL" amino acids 19 to 315 (297 residues), 90.6 bits, see alignment E=1e-29 PF12693: GspL_C" amino acids 325 to 442 (118 residues), 69.1 bits, see alignment E=4.3e-23

Best Hits

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 90% identity to bug:BC1001_3570)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>ABIE53_000305 general secretion pathway protein L (Paraburkholderia graminis OAS925)
MSTLIVLLPPRDPAVPSQEWQLPDLPFVLLDKSGRTQRAGRSALALLPRATSTVLMVAAR
DLLMMPATLPPLRGPKLRQALPNIVEDQLIQDPQTCHIAVDPQPAAGGRQVLAIIDRGWF
RFIYEAFSAAGHRSLRAVPVTRCLPEARLSAAPVDVAETVSAAEPALAGADASPRRDAAP
VASAADTLSDAATGAMPMVAAVLGAVVQTAPALLLEGAVETGTPRVELAIARGAQGEGLA
VPANAVNATLAALAGAMPVSLYMLTEVPGNEPSLGASSPARLAAHVHGASPLPFEQLARR
ALACRFDLCQFEFASQPWRLDRATLRRLRLPVLLAVGALLVAIIGANVQWLMLSRQRDAI
NTQMTELLLNAFPKTTVVLDAPDQMSRQLQQLRVAAGELSPDDFLSIADRLARALPPVPV
NGIAALDYHDRRLDVTFKPEVKLDPDFAARLARNGLNGAIDSNTGKWTIRNGQ