Protein Info for ABIE53_000135 in Paraburkholderia graminis OAS925

Annotation: Cof subfamily protein (haloacid dehalogenase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00702: Hydrolase" amino acids 2 to 227 (226 residues), 33.3 bits, see alignment E=9.7e-12 PF05116: S6PP" amino acids 3 to 74 (72 residues), 23.4 bits, see alignment E=6.1e-09 amino acids 151 to 241 (91 residues), 29.3 bits, see alignment E=1e-10 TIGR00099: Cof-like hydrolase" amino acids 4 to 260 (257 residues), 172.4 bits, see alignment E=1.3e-54 PF08282: Hydrolase_3" amino acids 5 to 261 (257 residues), 192.4 bits, see alignment E=1.9e-60 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 232 (228 residues), 98.4 bits, see alignment E=6.1e-32

Best Hits

KEGG orthology group: K07024, (no description) (inferred from 98% identity to bug:BC1001_3425)

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>ABIE53_000135 Cof subfamily protein (haloacid dehalogenase superfamily) (Paraburkholderia graminis OAS925)
MYKVIATDLDGTLLNADHQVDPFTVATVRKLESDGVQFVIATGRHFCDVAGIRDILGIKP
YLITSNGARIHAPDNTVIHADDLPPAIVQRLVQPEIVGAHGRVIVNLFADQAWLIDRDAP
ELLKFHQDSGFTYEVAELLAHDGVDIAKVLYIGDPADLAQVAANLAREFGDALYVTYSLP
DCLEVMTSNVSKGRALQIVLERVGVDAAHCVAFGDNMNDIDLLETAGHPFMMNNANPDLI
TRLPNVPRIGNNFEAGVAHHLRKLFSIDDELMA