Protein Info for ABIE53_000093 in Paraburkholderia graminis OAS925

Annotation: flagellar protein FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 20 to 333 (314 residues), 327.4 bits, see alignment E=6.1e-102 PF10135: Rod-binding" amino acids 58 to 104 (47 residues), 60.8 bits, see alignment 1.4e-20 PF01832: Glucosaminidase" amino acids 198 to 333 (136 residues), 127.1 bits, see alignment E=6.3e-41

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 96% identity to bug:BC1001_3387)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>ABIE53_000093 flagellar protein FlgJ (Paraburkholderia graminis OAS925)
MNSDTTNSAAAANDLSQRFALDVQGFAKLSAQAKASPQAGMKVAAQQFDAVFTQMMLKSM
RDATPQDGPFDSHDTATFTSMMDQQLSQHLSQKGIGVADAMLKQLMRNQGMQVSGANGAN
GAGGLAGMANALGGGSGGDEGQTAALNALAKAYGNAQANGQLAMGKGYSANSALTPPLKG
DGSSPKVDAFVDKLAGPAQAASAATGIPARFIIGQAALESGWGKSEIKKADGTTSHNVFG
IKATKDWTGKTVSTLTTEYVHGKPQRVVEKFRAYDSYQEAMTDYASLLKGNPRYAQVINS
AHDVKGFANGMQRAGYATDPHYAKKLMSIMDKMG