Protein Info for ABIE53_000052 in Paraburkholderia graminis OAS925

Annotation: tetratricopeptide (TPR) repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14559: TPR_19
  • amino acids 34 to 94 (61 residues), 32.5 bits, 8.2e-11
• PF13432: TPR_16
  • amino acids 64 to 110 (47 residues), 16.1 bits, 1.2e-05
  • amino acids 163 to 226 (64 residues), 41.2 bits, E=1.7e-13
  • amino acids 206 to 259 (54 residues), 32.1 bits, 1.2e-10
• PF07719: TPR_2
  • amino acids 91 to 123 (33 residues), 27.6 bits, see alignment (E = 1.9e-09)
  • amino acids 160 to 191 (32 residues), 26.7 bits, see alignment (E = 3.7e-09)
  • amino acids 193 to 226 (34 residues), 23.2 bits, see alignment (E = 5.1e-08)
  • amino acids 227 to 259 (33 residues), 25.4 bits, see alignment (E = 9.6e-09)
• PF13181: TPR_8
  • amino acids 92 to 123 (32 residues), 18.6 bits, see alignment (E = 1.5e-06)
  • amino acids 125 to 157 (33 residues), 12.2 bits, see alignment (E = 0.00018)
  • amino acids 160 to 191 (32 residues), 23.8 bits, see alignment (E = 3.2e-08)
  • amino acids 193 to 226 (34 residues), 25.6 bits, see alignment (E = 9e-09)
  • amino acids 227 to 259 (33 residues), 14.6 bits, see alignment (E = 3e-05)
• PF13414: TPR_11
  • amino acids 100 to 139 (40 residues), 29.3 bits, 5.1e-10
  • amino acids 136 to 173 (38 residues), 33.2 bits, 3.2e-11
  • amino acids 171 to 207 (37 residues), 36.6 bits, 2.7e-12
  • amino acids 200 to 236 (37 residues), 38.4 bits, 7.9e-13
• PF13374: TPR_10
  • amino acids 125 to 153 (29 residues), 18.9 bits, see alignment (E = 1.2e-06)
  • amino acids 164 to 188 (25 residues), 18.4 bits, see alignment (E = 1.7e-06)
• PF13174: TPR_6
  • amino acids 160 to 192 (33 residues), 12.3 bits, see alignment (E = 0.00023)
• PF00515: TPR_1
  • amino acids 160 to 191 (32 residues), 32.7 bits, see alignment (E = 4.5e-11)
  • amino acids 193 to 226 (34 residues), 30.6 bits, see alignment (E = 2e-10)
• PF13424: TPR_12
  • amino acids 161 to 224 (64 residues), 34.8 bits, E=1.5e-11
• PF07721: TPR_4
  • amino acids 161 to 183 (23 residues), 11.6 bits, see alignment (E = 0.00037)
  • amino acids 193 to 218 (26 residues), 13 bits, see alignment (E = 0.00013)
  • amino acids 227 to 252 (26 residues), 10.9 bits, see alignment (E = 0.00065)
• PF13176: TPR_7
  • amino acids 195 to 225 (31 residues), 15.3 bits, see alignment (E = 1.6e-05)
• PF13431: TPR_17
  • amino acids 282 to 312 (31 residues), 26.6 bits, see alignment (E = 4.3e-09)
• PF01075: Glyco_transf_9
  • amino acids 520 to 552 (33 residues), 27.3 bits, see alignment (E = 2.2e-09)

Best Hits

KEGG orthology group: None (inferred from 86% identity to bug:BC1001_3348)

Predicted SEED Role

"FOG: TPR repeat"

Protein Sequence (603 amino acids)

>ABIE53_000052 tetratricopeptide (TPR) repeat protein (Paraburkholderia graminis OAS925)
MEPQSKRPGGRTASPSSSPASGVDSLVNAALDAHQAGRLDTADSIYREVLAIDPANARAL
HYFGVLHYQRGQHADAATLMSHALKHDRHDAACWSNRGLAAAALGYLDEATICYDQALQL
QPDFADARNNFGVALQAQGALNEAVEQYRLAIASNPAFVDAHLNLGTALGKLGNFTEALA
CYRDALQLDANSAEAHFNAGNAHNALGEHEAAVASFERALALRPDYAEAHINLGSAIGKR
GDYAGAESHYRRAVALNPNPTNLVCLGGSLGAQGRLDEEETFYRDALAREPDYADAHQNL
AWLLLKRGDYKQGWAEFALRWRKSDYDALALPGVAEWRGEPLEGRRLLIVGEQGFGDHFQ
FLRYARVLHERGATVDVCVREPLLRLVQRVPGVHRAFAGKPDADYDFWVPMMSVPSCVGA
ELSSIPAQMPYLFADNAKVDAWRKKLQTSGKTKRKVGLVWAGSPVFGNDRYRSMALADLH
TLADVAKVSWYPLQKGPAHAQLAEAPEAFRAHDFSGELNDFEDTAALIMNLDLVIAVDTG
VAHLAGALGKPVWLLLPANSDWRWLEARSDSPWYPRMRLFRQQVLGDWAGVVREVVSALK
TGR