Protein Info for ABIE51_RS19170 in Lysobacter sp. OAE881

Annotation: COX15/CtaA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 21 to 126 (106 residues), 77.7 bits, see alignment E=4.3e-26 amino acids 145 to 377 (233 residues), 151.3 bits, see alignment E=1.7e-48

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 70% identity to psu:Psesu_0182)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>ABIE51_RS19170 COX15/CtaA family protein (Lysobacter sp. OAE881)
MTMPTEARAGSRPAVYRHFHRLAWLAVALAFGVIVFGAFVRLSNAGLSCPDWPTCYGRAA
WPTTAHQVVDHAATAIRPVEVHKAWREQFHRMIAGTLGVLVLGLALLAARRRKYGVVQVI
AASVLVGIGIPLYMHGEHVAASVLAIAGEAILLFAALRWSNVDLARVASITLAVIIFQAL
LGMWTVTWLLKPIVVMGHLLGGLLTFSLILWMAWRATHIPMRLAEAQLVRRLVIAGVVLL
GVQIALGGWTSANYAALACGNDFPTCVGQWWPRHDFREAFVLWRGIGVDYEGGILDGEAR
IAIQLAHRMMAMVVFVYLLWLAVRLIRTPGMRGWATLLGLLLFAQIGLGIANVKLGLPLS
VAVMHNAGAVLLLFVLVSLLARLRQPEP