Protein Info for ABIE51_RS19120 in Lysobacter sp. OAE881

Annotation: dihydroneopterin aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00526: FolB domain
  • amino acids 1 to 115 (115 residues), 108.8 bits, E=2e-35
• TIGR00525: dihydroneopterin aldolase
  • amino acids 2 to 114 (113 residues), 98.8 bits, E=2.8e-32
• PF02152: FolB
  • amino acids 4 to 113 (110 residues), 117.6 bits, E=2.1e-38

Best Hits

Swiss-Prot: 52% identical to FOLB_SHIFL: Dihydroneopterin aldolase (folB) from Shigella flexneri

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 81% identity to psu:Psesu_0196)

MetaCyc: 52% identical to dihydroneopterin aldolase (Escherichia coli K-12 substr. MG1655)
RXN-10856 [EC: 5.1.99.8]; Dihydroneopterin aldolase. [EC: 5.1.99.8, 4.1.2.25]

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25)" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25 or 5.1.99.8

Protein Sequence (117 amino acids)

>ABIE51_RS19120 dihydroneopterin aldolase (Lysobacter sp. OAE881)
MDHVFIEGLEIEALIGIYDWERRVRQPLVFDIEMAFDNRIPAATDAIADTLNYKAVSNRI
VEYVSQSSFELVETLAERVAQIVITEFGVQRVRLKLSKPGAVRGARAVGVMIERSAS