Protein Info for ABIE51_RS19025 in Lysobacter sp. OAE881

Annotation: thiol:disulfide interchange protein DsbA/DsbL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 100 to 246 (147 residues), 39.6 bits, see alignment E=9e-14 PF01323: DSBA" amino acids 103 to 250 (148 residues), 36.4 bits, see alignment E=7.2e-13

Best Hits

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 55% identity to psu:Psesu_2756)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>ABIE51_RS19025 thiol:disulfide interchange protein DsbA/DsbL (Lysobacter sp. OAE881)
MNSRLPRLAVVLTGLLVLSACSKQAPAPAETAAPAAPTAPAAPAETAPAPAAPATPAETA
AAPAPAPTAEAAPPQGPAPVAGTDYVEIAGGQPSEPTGGKIEVVEVFGYTCPHCAHFEPL
VEAWKAKQPADVKFVALAAPFGGYWEPYARAFYTAQTMGVLDKTHEAVFNAIHVDKVLPV
QPLPTNEQIGAFYAKYGVDGKQFASTMSSFAIEGKMKRASQFIARSGVDSTPTMVINGKY
KVTGKGFEDTLRIADHLIAQERAAKGGATNAGGAQ