Protein Info for ABIE51_RS18555 in Lysobacter sp. OAE881

Annotation: cysteine hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 14 to 185 (172 residues), 109.6 bits, E=1e-35

Best Hits

Swiss-Prot: 48% identical to Y2328_HALVD: Uncharacterized isochorismatase family protein HVO_2328 (HVO_2328) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K05993, isochorismatase [EC: 3.3.2.1] (inferred from 62% identity to rhi:NGR_c21780)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

• 2,3-dihydroxybenzoate biosynthesis (1/3 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• vibriobactin biosynthesis (1/9 steps found)
• bacillibactin biosynthesis (3/12 steps found)
• enterobactin biosynthesis (2/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of siderophore group nonribosomal peptides

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.2.1

Protein Sequence (204 amino acids)

>ABIE51_RS18555 cysteine hydrolase family protein (Lysobacter sp. OAE881)
MNAPRSALELDTRSALIPIDVQCGFDLPPWPPRNNPAMEANALRVLDAWRRAGLPLIHVR
HDSVMEGSVLARGHPGNAHRPGFVPLEGEPLVTKSVNAAFIGTDLDLRLRRLNIDTVVLF
GISTDMCVSTTARVAANLGYRTIVIGDACACFDLKDADGSVIPADAIQRAHLATLRAEFA
QVVESDVVIEALRVSERAIGARAS