Protein Info for ABIE51_RS18500 in Lysobacter sp. OAE881
Annotation: ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to YBBA_SHIFL: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Shigella flexneri
KEGG orthology group: K02003, (no description) (inferred from 71% identity to ppw:PputW619_1759)MetaCyc: 51% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427
Predicted SEED Role
No annotation
MetaCyc Pathways
- lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (209 amino acids)
>ABIE51_RS18500 ABC transporter ATP-binding protein (Lysobacter sp. OAE881) MLPSGELVILDDVSFDIAPGDTVAIVGASGSGKSTLLSLLAGLDTPSSGRVVLDGETLST LDEDGRARVRGEKVGFVFQNFQLLPSLTALENVMLPLELRGDREVDAPARAILEKVGLGQ RLNHYPRQLSGGEQQRVALARAFVTRPSLLFADEPTGNLDTHTGQAIIELLFELNAQAGT TLVLVTHDEHLASRCGRLLRLDSGRLVAS