Protein Info for ABIE51_RS18420 in Lysobacter sp. OAE881

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF00364: Biotin_lipoyl" amino acids 5 to 76 (72 residues), 71.2 bits, see alignment E=2.4e-23 PF07992: Pyr_redox_2" amino acids 135 to 462 (328 residues), 230.6 bits, see alignment E=1.2e-71 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 135 to 594 (460 residues), 495.3 bits, see alignment E=8.2e-153 PF01134: GIDA" amino acids 136 to 193 (58 residues), 22.8 bits, see alignment 2e-08 PF12831: FAD_oxidored" amino acids 136 to 172 (37 residues), 33.3 bits, see alignment 1.6e-11 PF00070: Pyr_redox" amino acids 306 to 380 (75 residues), 79 bits, see alignment E=1.4e-25 PF02852: Pyr_redox_dim" amino acids 481 to 589 (109 residues), 119.9 bits, see alignment E=2.6e-38

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 83% identity to psu:Psesu_0311)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>ABIE51_RS18420 dihydrolipoyl dehydrogenase (Lysobacter sp. OAE881)
MATIEVKVPDIGDYDGVPVIELLVAVGDTVKKDQGLVTLESDKATMEVPSSDEGVVKEIK
VKVGDKVAEGAVIVVLEGAGGAAAPKAEAPKAAAPAAPAAPEQARPPVAPSPAAPPSEAP
KPALGTGRKADIECRIVVLGSGPGGYTAAFRAADLGLDTVLIERYASLGGVCLNVGCIPS
KALLHAAALIDEAAHSSDIGISFGKPKIDLDKLRDFKQNKVVGQFTKGLGGMAKQRKVRT
VQGVGKFVSPNELEITGDDGKTQLLRFEQCIIAAGSQAVKLPNFPWDDPRIMDSTDALEL
AEVPKKLLVVGGGIIGLEMATVYRALGSEVTVVEFMDQLMPGADKDLVKPLADRLKKQGV
IVHLKTKAAKVEASKSGITVSFEAAEAGATPALENGTWDRVLVAVGRAPNGNKIDADKAG
VQVTDRGFIPVDRQMRTNVPHIFAIGDLVGQPMLAHKATHEGKLAAEVAAGEKREWVARV
VPSVAYTDPEIAWVGVTETEAKAKGLHVGVGKFPWAASARAVGIGRGEGFTKLIFDEKTH
RIIGGGITGVHAGDLISEVALAIEMGAEAGDIGATIHPHPTLSETVAMAAEVYEGTITDL
YIPKKK