Protein Info for ABIE51_RS17990 in Lysobacter sp. OAE881

Annotation: dethiobiotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF13500: AAA_26" amino acids 3 to 208 (206 residues), 121.7 bits, see alignment E=3.5e-39 PF01656: CbiA" amino acids 6 to 208 (203 residues), 36.6 bits, see alignment E=4e-13 TIGR00347: dethiobiotin synthase" amino acids 6 to 176 (171 residues), 159.3 bits, see alignment E=4.5e-51

Best Hits

Swiss-Prot: 69% identical to BIOD_XANC5: ATP-dependent dethiobiotin synthetase BioD (bioD) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 70% identity to xal:XALc_2723)

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>ABIE51_RS17990 dethiobiotin synthase (Lysobacter sp. OAE881)
MTRGWFVTGTDTGIGKSLASATLLHTLRAGGQRAVGMKPLASGCESTPDGWRNEDALALQ
AASDPRPAYDDVNPFALPNPLAPELAAADACIRVTLAPIVSAFQRLSSQADAVVVEGVGG
WAAPLSADLDQVDLVRALHLPVVMVVGLRLGCINHARLTARAIEHDGLRLAGWIANDIDP
AMARADDNFELLKQRLPVKCWGRLPFREMPDPAQLWSLLQPA