Protein Info for ABIE51_RS17845 in Lysobacter sp. OAE881

Annotation: RNA pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 7 to 129 (123 residues), 84.6 bits, E=3.3e-28

Best Hits

Swiss-Prot: 86% identical to RPPH_XANC8: RNA pyrophosphohydrolase (rppH) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 86% identity to xca:xccb100_0508)

Predicted SEED Role

"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (195 amino acids)

>ABIE51_RS17845 RNA pyrophosphohydrolase (Lysobacter sp. OAE881)
MIDPDGYRPNVGIVLMHPDGRVFWARRVHRDGWQFPQGGMNSDETPLEAMYRELREETGL
LPEHVEVLGATPGWLRYRLPQRAIRRNDRLVCIGQKQVWFLLRLCGQESDLRLDLTDKPE
FDHWRWVDFWYPVEHVVMFKRSVYARALRHLAPAARQVAGPAAVPTPGPEFRPQDQIGRS
RGARWRGAGAGSGPR