Protein Info for ABIE51_RS17660 in Lysobacter sp. OAE881

Annotation: malonic semialdehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF00881: Nitroreductase" amino acids 30 to 161 (132 residues), 50.2 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 72% identical to Y482_STRMK: Putative NADH dehydrogenase/NAD(P)H nitroreductase Smlt0482 (Smlt0482) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 72% identity to sml:Smlt0482)

MetaCyc: 60% identical to putative malonic semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
RXN-8974 [EC: 1.1.1.298]

Predicted SEED Role

"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.298

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>ABIE51_RS17660 malonic semialdehyde reductase (Lysobacter sp. OAE881)
MSQNTPPLPASALDQLFRTARTHNELKGEVSDETLRELYDLAKWGPTSANMSPLRLVFVK
SPEAKAKLAPALDEGNHAKTMAAPVTAIVAHDLAFYEKLPYLFPHTDARGWFEGKPEADL
TTIALRNGSLQGAYVLMAARALGLDTGPMSGFNNALVDETFFAGTKIKSNFLINLGHGDT
AKLFPRSPRLSFDEAARIL