Protein Info for ABIE51_RS17505 in Lysobacter sp. OAE881

Annotation: winged helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 transmembrane" amino acids 175 to 197 (23 residues), see Phobius details PF00486: Trans_reg_C" amino acids 38 to 112 (75 residues), 63.4 bits, see alignment E=2.5e-21 PF07676: PD40" amino acids 269 to 295 (27 residues), 23.7 bits, see alignment (E = 5.3e-09) amino acids 373 to 395 (23 residues), 23.1 bits, see alignment (E = 8.2e-09) amino acids 501 to 535 (35 residues), 29.2 bits, see alignment (E = 9.9e-11)

Best Hits

KEGG orthology group: None (inferred from 44% identity to sml:Smlt3907)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (780 amino acids)

>ABIE51_RS17505 winged helix-turn-helix domain-containing protein (Lysobacter sp. OAE881)
MQRTLEPSTPPLPSERLRVGECVVDVPLREIRAPGKRRPLRITPKSMGVLLVLVEQAGRV
VSRDSLMTEVWPDTLPTNDVVTQAITQLRKAFDDERGNPRYIETIAKNGYRLLAPIEWIH
TGGPAASADVVASDERWSDPTRTTAKYPAIAGADPSEPLAPVPFPASSTPRGTWTSIASV
IFVVALLVAGLVAWALIRAPAQPEVAPVAVTGMQGLRSERPYRLITSAPGFELSPALSPD
AGLVAYVAIPEGQRGTAIMVQTTEQTQPRQLTRPPEGTDDASPVWSPDGRWIAFMRLSES
SCSIRLVTPNARAEHEVGVCDRRSPPTFDWTPDSNGLIFGSMSTDQGTVGLRVLNLDSGQ
WQPIEYPHDPDELDTDPRYSPDGRWIVFVRNAPLGDFWRIPAQGGNAERLSRLRADLRGW
DWSPTGRGLLFSAMVDGEYRLFRLDTSTGEARQMGVDDGQAPVAARSRRAIAFVQRRPYF
GLYRVQLADGDGPGRVHVVEPLFASAARDLLPSIAPDGRQLAFVSDRSGSNGLWVGDVSQ
PDTLRMMGGVRPGTRYAPAWSPDSRRLLATGIDAQGRGVVQEVLAASGQVSTLPVPDAEP
LQAQYSVDPNRLFVLAASEEGAPQLRLYDRSATPWRVLGRIDGVSHFEVDGARNRVLFTR
LTEAGLWEVPLDLGAASVRQVSASVPTADRYRMWTVAPDGEIRYLERLQDCAASLRRIVP
ADPAPPRCLDQLRRSAVNGFSLGGPRNEAAYLALVDWDGADIGYMELPKETTEVVPGWVK