Protein Info for ABIE51_RS17440 in Lysobacter sp. OAE881

Annotation: bifunctional DedA family/phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 transmembrane" amino acids 20 to 53 (34 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details amino acids 293 to 318 (26 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details amino acids 448 to 465 (18 residues), see Phobius details PF09335: SNARE_assoc" amino acids 40 to 163 (124 residues), 79.7 bits, see alignment E=4e-26 PF01569: PAP2" amino acids 329 to 432 (104 residues), 40.9 bits, see alignment E=2.6e-14 PF14067: LssY_C" amino acids 496 to 606 (111 residues), 38.9 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: None (inferred from 59% identity to sml:Smlt3883)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (669 amino acids)

>ABIE51_RS17440 bifunctional DedA family/phosphatase PAP2 family protein (Lysobacter sp. OAE881)
MEPAWIESATTWIAEHPVAAGAVIFLIAFCDAVVLLGIVVPALPLLFAVGALVGLGHISG
PYALVCATLGAFIGDALSYWVGHRWGPQLRSRWPFSRYPQWLDRGEAMFRRHGVKSIFIA
RFVGAVRPFVPAIAGMLHMPLRRYALPSLVACIAWSALFLAPGWVLGRSYDAVAAVADRL
ALVLGALAVAVALVWAVVLYTWRWFADHADTLLARALRWTRQHPRLGPYAAALIDPNRPE
SPSLLMLAVCLLAISWAWFTLVASLLASGGPLALDHTIHDFMWSLRNPLADRLMAALACI
GDASVLGPAVLVALAYLLWRKRWMAAAHFAAAIVFGLVFTSLLEAVIDMPRPPTAPAGFG
FPSVAVTMSTIVFGFFAVLIARELPGRTRVWPYLLAGVITTLVAFSRLYLGAHWPSDLVG
GTLFGVLWLLALGIAYRRHVQRSFWMRPLAWLFYGTFAIAALWHAPRTADTLLARFAAAT
PTSVMDAEAWWREGWSELPAQRNERDQRRRWPLDVQVAGSLDPLRERLEARGWHVQPQAD
WIATLGLLDDDTSASEQPVLPATLDAQAETLLMVHPGGSENEEFVLRLWRAPVRLDDGTP
LWIGTSQTLRLNKPLAVAALWLPVSDDGRAHAMVREALKDLDIAEDAHPHGDTPVLRVRT
TTPANASGK