Protein Info for ABIE51_RS17130 in Lysobacter sp. OAE881

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details PF00375: SDF" amino acids 18 to 427 (410 residues), 381.6 bits, see alignment E=2.3e-118

Best Hits

KEGG orthology group: K03309, dicarboxylate/amino acid:cation (Na+ or H+) symporter, DAACS family (inferred from 56% identity to bsb:Bresu_1919)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>ABIE51_RS17130 dicarboxylate/amino acid:cation symporter (Lysobacter sp. OAE881)
MSHIALPEARMPAKGMPLHIKVLLGFIAGAVLGLFAHFIAPGSPFVLGAVSYVAQPIGQI
FLALLFMLVLPLMFSALVLGVAELGDVASLGRLGWRTLIYTAVVTLIAVAIGLVMVNLIA
PGQGLDRGMLDQAMAQGAQKAGEIAATGQQLDFMKMLLGIVPKNVLAAAVDDKQKLGVMF
FALMLGIGLVMTPSPHTQAFKNAVQGLFEICMRLIGMIIKLAPYAVACLMFALCAQFGWE
LLLVLGKFALTVVLAIAVHMFIVLPLWVKFAGGMSPRAFFRGSQEALLTAFATASSTGTL
PVTLRVAEQNLKLPRKVARFVLTVGASANHHGTALFEGITVLFLAQAFGVELTLMHQVMV
LGLCLLGGIGTAGVPAGSLPVIAMICAVLGIPAEGVGIILGVDRFLDMCRTALNVTGDLA
TAVVVANRSGDVAESEVVMPADTAPEAAG