Protein Info for ABIE51_RS17070 in Lysobacter sp. OAE881
Annotation: ribonucleotide-diphosphate reductase subunit beta
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 79% identity to sml:Smlt0248)Predicted SEED Role
"Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
- superpathway of purine nucleotide salvage (12/14 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
- adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
- guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
- pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
- adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
- guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.17.4.1
Use Curated BLAST to search for 1.17.4.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (337 amino acids)
>ABIE51_RS17070 ribonucleotide-diphosphate reductase subunit beta (Lysobacter sp. OAE881) MSHTPRLLDPGFDLTLRPMRYPQFYEMYRDAIRNTWTVEEVDFSLDVNDLKHKLGPAERH LIERLVAFFATGDSIVANNLVLNLYQHINAPEARMYLSRQLYEEALHVQFYLTLLDTYLP DPVARAKAFAAVENIPSIRAKAEFCFKWIDSIQGLQRIETVEQRRQFLLNLICFACCIEG LFFFAAFAYVYYLRSRGLLHGLASGTNWVFRDESCHMAFAFEVIRTAREEEPHLFDDELK AQVVRMLEEAVECEMQFAQDVLSGGVAGLSPKDMRQYLQYCADQRLAQLGLPKHFNATNP FAFMDLQDVQEVTNFFERRVSAYQVGVEGEVAFDAAF