Protein Info for ABIE51_RS16700 in Lysobacter sp. OAE881

Annotation: flagellar basal body L-ring protein FlgH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02107: FlgH" amino acids 38 to 216 (179 residues), 189 bits, see alignment E=2.8e-60

Best Hits

Swiss-Prot: 56% identical to FLGH_XANC8: Flagellar L-ring protein (flgH) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K02393, flagellar L-ring protein precursor FlgH (inferred from 56% identity to xca:xccb100_2244)

Predicted SEED Role

"Flagellar L-ring protein FlgH" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>ABIE51_RS16700 flagellar basal body L-ring protein FlgH (Lysobacter sp. OAE881)
MAGATLALAGCAAVVGDVRPFAPMAAPPTAIVAPAAPASEGSIYASRSLRLFEDNKARDV
GDLVTIVLVENTSARAQANTSVSKESGIDMAAPTIAGVPITYKGNPILEASVEGSRDFQG
AGNSTQSNRLSGSVTATVIQNLGNGNLLVRGQKQLRLNQGDELIQVQGIVRTADIGPDNR
ISSDRVGDAQIVYGGRGTLARSNAMGWLGRFFNSAVYPY