Protein Info for ABIE51_RS16695 in Lysobacter sp. OAE881

Annotation: flagellar basal-body rod protein FlgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 4 to 260 (257 residues), 374 bits, see alignment E=3.9e-116 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 136 (133 residues), 163.3 bits, see alignment E=1.3e-51 amino acids 144 to 243 (100 residues), 112.9 bits, see alignment E=2.8e-36 PF00460: Flg_bb_rod" amino acids 7 to 35 (29 residues), 41.9 bits, see alignment (E = 7.7e-15) PF06429: Flg_bbr_C" amino acids 182 to 259 (78 residues), 93.1 bits, see alignment E=9.1e-31

Best Hits

Swiss-Prot: 61% identical to FLGG_ECOL6: Flagellar basal-body rod protein FlgG (flgG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 74% identity to psu:Psesu_1516)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ABIE51_RS16695 flagellar basal-body rod protein FlgG (Lysobacter sp. OAE881)
MTQALWIAKTGLDAQQTRMAVISNNLSNVNTTGFKRDRAEFQDLLYQTVRQPGGATSEQT
QAPTGLSTGTGVRVAATAKEFSQGNLNVTGGALDVGIDGRGFFEVLMPDGSSAYTRDGSF
KRNSQGEMVTSDGYPVQPGIQFPEGTQSVTIGADGTVSVKVQGQADDVQVGALTLADFVN
PSGLQAIGKNLFVETGASGPAQQGAPGTNGIGQLAQGQLEGSNVNVVEELVSMIETQRAY
ETNAKAISTTDSMLGFLNNNL