Protein Info for ABIE51_RS16680 in Lysobacter sp. OAE881

Annotation: flagellar hook capping FlgD N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03963: FlgD
  • amino acids 9 to 75 (67 residues), 82.7 bits, E=2.6e-27
• PF13861: FLgD_tudor
  • amino acids 84 to 216 (133 residues), 51.4 bits, E=1.5e-17
• PF13860: FlgD_ig
  • amino acids 113 to 174 (62 residues), 66.6 bits, E=2.5e-22

Best Hits

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 63% identity to xop:PXO_01011)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Protein Sequence (220 amino acids)

>ABIE51_RS16680 flagellar hook capping FlgD N-terminal domain-containing protein (Lysobacter sp. OAE881)
MTSISDFVSTYGASATGTDTTKKSDSLGQADFLRLMTEQLQHQDPLNPMENSEFLGQLAQ
FSTVQGIQGLQTSMDGFKGSLATDQMLRGASLVGRSVLVPSAKMALGAEGSVNGVVAAPD
AGTVTFDITDANGQSVRKITVQAEKAGEVAFEWDGKDASGNRLAAGSYGVTATIGSGETK
KDLSTYVESRVDSVTVGSDGVFLDLAGLGTAPLDYVLRIR