Protein Info for ABIE51_RS16545 in Lysobacter sp. OAE881

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05690: ThiG
  • amino acids 16 to 262 (247 residues), 373.6 bits, E=2.1e-116

Best Hits

Swiss-Prot: 89% identical to THIG_STRMK: Thiazole synthase (thiG) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 89% identity to sml:Smlt3775)

MetaCyc: 54% identical to thiazole synthase (Bacillus subtilis subtilis 168)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (4/7 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Protein Sequence (268 amino acids)

>ABIE51_RS16545 thiazole synthase (Lysobacter sp. OAE881)
MTAPHSPQFPADPLVIAGKAYASRLLTGTGKFTDLEQTRLATEAAGAQIVTVAIRRSNIG
QNPGEPNLLDVLPPDRYTILPNTAGCYTADDAVRTCRLARELLDGHSLVKLEVLGDQKTL
YPDVVQTLAAAELLVKDGFDVMVYTSDDPILAKRLEEIGCVAVMPLAAPIGSGLGVQNKY
NLLEIVENAKVPIIVDAGVGTASDAAIAMELGCDGVLMNTAIAGAKDPVLMAHAMKLAVD
AGRAAFKAGRIPRKRFASASSPVDGLIG