Protein Info for ABIE51_RS16405 in Lysobacter sp. OAE881

Annotation: TonB-dependent hemoglobin/transferrin/lactoferrin family receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 48 to 764 (717 residues), 437.4 bits, see alignment E=1e-134 TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 48 to 764 (717 residues), 368.3 bits, see alignment E=8.2e-114 PF07715: Plug" amino acids 61 to 172 (112 residues), 83.8 bits, see alignment E=1.2e-27 PF00593: TonB_dep_Rec" amino acids 282 to 724 (443 residues), 222.4 bits, see alignment E=2.2e-69

Best Hits

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (764 amino acids)

>ABIE51_RS16405 TonB-dependent hemoglobin/transferrin/lactoferrin family receptor (Lysobacter sp. OAE881)
MHPVRNTLALALMLAIPAVAIADDVAPDGSDPSIAAAATGAIAANEFDRIVVTATLTERA
LDDVPNVVTAINRDEMDRNLVRDLKGLFRYEPGITVSGGSGRFGGLGDIRIRGLGGNRVR
IETDGIAVPDAFSIGSFSSANRNFVDLDTLKAVEVVRGPGSALYGSDALGGVVSFVTKDP
SDYLTDGKDAYFGLKFGYFGEDNGLFGGATAAFGGERWSGLAAIGHHQGQERENMGENRG
TGSSRTAPNPQEYDGRSLLAKLVFETSENQRFKLTVEGNEDNVDTDVLTALGDTSTIPGT
PPSVRVASQTGDDKQTRARVAFSHEVDALDAAFADSLQWQLYRQDSETTQRTREERATLR
NGVAINPVLREREFNFDQRLTGFDAVLHKEATTGPADHAITYGLELARTEFKQKRDGRAT
NLLTGTVTNVISPDTFPVRDFPVSDTTQAALFVQDEMSFAGGTFRLIPAVRVDYYKLEPK
PDATFTDDNPGVEVAELSETSVSPKLGAVWHFSEGWSLFGGYQHGFRAPPYSDVNLGFTN
LQFGYTAIPNPDLKPEKSNGVELGLRFSNEAVYAEVSGYYNRYDDFIESSVQLSAPPQTP
LIVFQSQNIEDAEIHGIEARAGVDLGAYSDALAGWSIRGAAAWSKGEDRTTNEPLPSIDP
LRATLGVAYDADTWGVELAGRFAARKDDLPAANQFEVPGYGVVDLLAHWNFAPGAVFDVG
VFNLADRKYWDAADVPAGTLASSTVLDRYTSSGRNVGVSLAVSW